Kallikrein 8 (KLK8) (NM_007196) Human Mass Spec Standard
CAT#: PH308152
KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127)
View other "Kallikrein 8" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208152 |
Predicted MW | 28.1 kDa |
Protein Sequence |
>RC208152 protein sequence
Red=Cloning site Green=Tags(s) MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQG DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009127 |
RefSeq Size | 1023 |
RefSeq ORF | 780 |
Synonyms | HNP; NP; NRPN; PRSS19; TADG14 |
Locus ID | 11202 |
Cytogenetics | 19q13.41 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408269 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416130 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430111 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408269 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
CNY 3080.00 |
|
LY416130 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
CNY 3080.00 |
|
LY430111 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
CNY 3080.00 |
|
TP308152 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP710038 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, residues 33-260aa, with C-terminal DDK tag, expressed in sf9 cells. |
CNY 4020.00 |
|
TP720648 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
CNY 1800.00 |
|
TP761586 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Kallikrein 8产品