CRKL (NM_005207) Human Mass Spec Standard
CAT#: PH308129
CRKL MS Standard C13 and N15-labeled recombinant protein (NP_005198)
View other "CRKL" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CRKL MS Standard C13 and N15-labeled recombinant protein (NP_005198) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208129 |
Predicted MW | 33.6 kDa |
Protein Sequence |
>RC208129 representing NM_005207
Red=Cloning site Green=Tags(s) MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN GRKGLFPFTHVKIFDPQNPDENE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005198 |
RefSeq Size | 5235 |
RefSeq ORF | 909 |
Locus ID | 1399 |
Cytogenetics | 22q11.21 |
Summary | This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic.[provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417444 | CRKL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417444 | Transient overexpression lysate of v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL) |
CNY 3080.00 |
|
TP308129 | Recombinant protein of human v-crk sarcoma virus CT10 oncogene homolog (avian)-like (CRKL), 20 µg |
CNY 2900.00 |