NDUFAF4 (NM_014165) Human Mass Spec Standard
CAT#: PH308120
NDUFAF4 MS Standard C13 and N15-labeled recombinant protein (NP_054884)
View other "NDUFAF4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NDUFAF4 MS Standard C13 and N15-labeled recombinant protein (NP_054884) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208120 |
Predicted MW | 20.3 kDa |
Protein Sequence |
>RC208120 protein sequence
Red=Cloning site Green=Tags(s) MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYV DSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQ EYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054884 |
RefSeq Size | 2411 |
RefSeq ORF | 525 |
Synonyms | bA22L21.1; C6orf66; HRPAP20; HSPC125; MC1DN15; My013 |
Locus ID | 29078 |
Cytogenetics | 6q16.1 |
Summary | NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415455 | NDUFAF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415455 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4 (NDUFAF4), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP308120 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4 (NDUFAF4), 20 µg |
CNY 2900.00 |
其它NDUFAF4产品