SLAP2 (SLA2) (NM_032214) Human Mass Spec Standard
CAT#: PH308103
SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590)
View other "SLAP2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208103 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC208103 protein sequence
Red=Cloning site Green=Tags(s) MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115590 |
| RefSeq Size | 2569 |
| RefSeq ORF | 783 |
| Synonyms | C20orf156; MARS; SLAP-2; SLAP2 |
| Locus ID | 84174 |
| Cytogenetics | 20q11.23 |
| Summary | This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406314 | SLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410277 | SLA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406314 | Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 2 |
CNY 3080.00 |
|
| LY410277 | Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 1 |
CNY 3080.00 |
|
| TP308103 | Recombinant protein of human Src-like-adaptor 2 (SLA2), transcript variant 1, 20 µg |
CNY 2900.00 |
