Nurim (NRM) (NM_007243) Human Mass Spec Standard
CAT#: PH308090
NRM MS Standard C13 and N15-labeled recombinant protein (NP_009174)
View other "Nurim" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NRM MS Standard C13 and N15-labeled recombinant protein (NP_009174) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208090 |
| Predicted MW | 29.4 kDa |
| Protein Sequence |
>RC208090 protein sequence
Red=Cloning site Green=Tags(s) MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009174 |
| RefSeq Size | 1767 |
| RefSeq ORF | 786 |
| Synonyms | NRM29 |
| Locus ID | 11270 |
| Cytogenetics | 6p21.33 |
| Summary | The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416103 | NRM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416103 | Transient overexpression lysate of nurim (nuclear envelope membrane protein) (NRM) |
CNY 3080.00 |
|
| TP308090 | Recombinant protein of human nurim (nuclear envelope membrane protein) (NRM), 20 µg |
CNY 2900.00 |

