CRCP (NM_001040647) Human Mass Spec Standard
CAT＃: PH308011
CRCP MS Standard C13 and N15-labeled recombinant protein (NP_001035737)
View other "CRCP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CRCP MS Standard C13 and N15-labeled recombinant protein (NP_001035737) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208011 |
| Predicted MW | 13.1 kDa |
| Protein Sequence |
>RC208011 protein sequence
Red=Cloning site Green=Tags(s) MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEE SEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035737 |
| RefSeq Size | 2721 |
| RefSeq ORF | 345 |
| Synonyms | C17; CGRP-RCP; CGRPRCP; POLR3I; POLR3J; RCP; RCP9; RPC9 |
| Locus ID | 27297 |
| Cytogenetics | 7q11.21 |
| Summary | This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415237 | CRCP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421791 | CRCP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415237 | Transient overexpression lysate of CGRP receptor component (CRCP), transcript variant 1 |
CNY 3080.00 |
|
| LY421791 | Transient overexpression lysate of CGRP receptor component (CRCP), transcript variant 2 |
CNY 3080.00 |
|
| PH317032 | CRCP MS Standard C13 and N15-labeled recombinant protein (NP_055293) |
CNY 19520.00 |
|
| TP308011 | Recombinant protein of human CGRP receptor component (CRCP), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317032 | Recombinant protein of human CGRP receptor component (CRCP), transcript variant 1, 20 µg |
CNY 2900.00 |
