HSPC111 (NOP16) (NM_016391) Human Mass Spec Standard
CAT#: PH308009
NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475)
View other "HSPC111" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NOP16 MS Standard C13 and N15-labeled recombinant protein (NP_057475) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208009 |
| Predicted MW | 21.2 kDa |
| Protein Sequence |
>RC208009 protein sequence
Red=Cloning site Green=Tags(s) MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRK RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNY YQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057475 |
| RefSeq Size | 1071 |
| RefSeq ORF | 534 |
| Synonyms | HSPC111; HSPC185 |
| Locus ID | 51491 |
| Cytogenetics | 5q35.2 |
| Summary | This gene encodes a protein that is localized to the nucleolus. Expression of this gene is induced by estrogens and Myc protein and is a marker of poor patient survival in breast cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413994 | NOP16 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413994 | Transient overexpression lysate of NOP16 nucleolar protein homolog (yeast) (NOP16) |
CNY 3080.00 |
|
| TP308009 | Recombinant protein of human NOP16 nucleolar protein homolog (yeast) (NOP16), 20 µg |
CNY 2900.00 |
其它HSPC111产品
