UBC3B (UBE2R2) (NM_017811) Human Mass Spec Standard
CAT#: PH307977
UBE2R2 MS Standard C13 and N15-labeled recombinant protein (NP_060281)
View other "UBC3B" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | UBE2R2 MS Standard C13 and N15-labeled recombinant protein (NP_060281) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207977 |
Predicted MW | 27 kDa |
Protein Sequence |
>RC207977 representing NM_017811
Red=Cloning site Green=Tags(s) MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPY SPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA NVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDL YDDDIDDEDEEEEDADCYDDDDSGNEES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060281 |
RefSeq Size | 4457 |
RefSeq ORF | 714 |
Synonyms | CDC34B; E2-CDC34B; UBC3B |
Locus ID | 54926 |
Cytogenetics | 9p13.3 |
Summary | Protein kinase CK2 is a ubiquitous and pleiotropic Ser/Thr protein kinase involved in cell growth and transformation. This gene encodes a protein similar to the E2 ubiquitin conjugating enzyme UBC3/CDC34. Studies suggest that CK2-dependent phosphorylation of this ubiquitin-conjugating enzyme functions by regulating beta-TrCP substrate recognition and induces its interaction with beta-TrCP, enhancing beta-catenin degradation. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413520 | UBE2R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413520 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2R 2 (UBE2R2) |
CNY 3080.00 |
|
TP307977 | Recombinant protein of human ubiquitin-conjugating enzyme E2R 2 (UBE2R2), 20 µg |
CNY 2900.00 |
|
TP720963 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2R 2 (UBE2R2) |
CNY 1800.00 |