IGJ (JCHAIN) (NM_144646) Human Mass Spec Standard
CAT#: PH307932
IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207932 |
Predicted MW | 18.1 kDa |
Protein Sequence |
>RC207932 protein sequence
Red=Cloning site Green=Tags(s) MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY GGETKMVETALTPDACYPD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_653247 |
RefSeq Size | 1413 |
RefSeq ORF | 477 |
Synonyms | IGCJ; IGJ; JCH |
Locus ID | 3512 |
Cytogenetics | 4q13.3 |
Summary | Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403400 | IGJ HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403400 | Transient overexpression lysate of immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ) |
CNY 3080.00 |
|
TP307932 | Recombinant protein of human immunoglobulin J polypeptide, linker protein for immunoglobulin alpha and mu polypeptides (IGJ), 20 µg |
CNY 2900.00 |