Pentraxin 3 (PTX3) (NM_002852) Human Mass Spec Standard
CAT#: PH307922
PTX3 MS Standard C13 and N15-labeled recombinant protein (NP_002843)
View other "Pentraxin 3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PTX3 MS Standard C13 and N15-labeled recombinant protein (NP_002843) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207922 |
| Predicted MW | 41.8 kDa |
| Protein Sequence |
>RC207922 representing NM_002852
Red=Cloning site Green=Tags(s) MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCDCGQEHSEWDKLFIMLENSQMRE RMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDELLQATRDAGRRLARMEGAEAQ RPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCETAILFPMRSKKIFGSVHPVRPMRLESFSAC IWVKATDVLNKTILFSYGTKRNPYEIQLYLSYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGL TSLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRE TGGAESCHIRGNIVGWGVTEIQPHGGAQYVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002843 |
| RefSeq Size | 1908 |
| RefSeq ORF | 1143 |
| Synonyms | TNFAIP5; TSG-14 |
| Locus ID | 5806 |
| Cytogenetics | 3q25.32 |
| Summary | This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. [provided by RefSeq, Jun 2016] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419080 | PTX3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419080 | Transient overexpression lysate of pentraxin-related gene, rapidly induced by IL-1 beta (PTX3) |
CNY 3080.00 |
|
| TP307922 | Recombinant protein of human pentraxin-related gene, rapidly induced by IL-1 beta (PTX3), 20 µg |
CNY 2900.00 |
|
| TP701050 | Purified recombinant protein of Human pentraxin 3, long (PTX3), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
其它Pentraxin 3产品
