ATP5PD (NM_006356) Human Mass Spec Standard
CAT#: PH307908
ATP5H MS Standard C13 and N15-labeled recombinant protein (NP_006347)
View other "ATP5PD" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ATP5H MS Standard C13 and N15-labeled recombinant protein (NP_006347) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207908 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC207908 protein sequence
Red=Cloning site Green=Tags(s) MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDF EKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAF PETKLDKKKYPYWPHQPIENL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006347 |
RefSeq Size | 628 |
RefSeq ORF | 483 |
Synonyms | APT5H; ATP5H; ATPQ |
Locus ID | 10476 |
Cytogenetics | 17q25.1 |
Summary | Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the d subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. In addition, three pseudogenes are located on chromosomes 9, 12 and 15. [provided by RefSeq, Jun 2010] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416696 | ATP5H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416696 | Transient overexpression lysate of ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (ATP5H), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
TP307908 | Recombinant protein of human ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (ATP5H), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |