PFD6 (PFDN6) (NM_014260) Human Mass Spec Standard
CAT#: PH307901
PFDN6 MS Standard C13 and N15-labeled recombinant protein (NP_055075)
View other "PFD6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | PFDN6 MS Standard C13 and N15-labeled recombinant protein (NP_055075) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207901 |
Predicted MW | 14.6 kDa |
Protein Sequence |
>RC207901 protein sequence
Red=Cloning site Green=Tags(s) MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG EARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055075 |
RefSeq Size | 602 |
RefSeq ORF | 387 |
Synonyms | H2-KE2; HKE2; KE-2; PFD6 |
Locus ID | 10471 |
Cytogenetics | 6p21.32 |
Summary | PFDN6 is a subunit of the heteromeric prefoldin complex that chaperones nascent actin (see MIM 102560) and alpha- and beta-tubulin (see MIM 602529 and MIM 191130, respectively) chains pending their transfer to the cytosolic chaperonin containing TCP1 (MIM 186980) (CCT) complex (Hansen et al., 1999 [PubMed 10209023]).[supplied by OMIM, Jul 2010] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415391 | PFDN6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415391 | Transient overexpression lysate of prefoldin subunit 6 (PFDN6) |
CNY 3080.00 |
|
TP307901 | Recombinant protein of human prefoldin subunit 6 (PFDN6), 20 µg |
CNY 2900.00 |