C13orf31 (LACC1) (NM_153218) Human Mass Spec Standard
CAT#: PH307834
C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_694950)
View other "C13orf31" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_694950) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207834 |
| Predicted MW | 47.8 kDa |
| Protein Sequence |
>RC207834 protein sequence
Red=Cloning site Green=Tags(s) MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDNCEIETSNGLS ALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFIDQLFTDVYNFEFEDLQVTFRG GLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTIITSSLIPDIFIHGFTTRTGGISYIPTLSSF NLFSSSKRRDPKVVVQENLRRLANAAGFNVEKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAAL GADCIPIVFADPVKKACGVAHAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESA EAFHNLHPACVQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG TQIGFISIKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_694950 |
| RefSeq Size | 4124 |
| RefSeq ORF | 1290 |
| Synonyms | C13orf31; FAMIN; JUVAR |
| Locus ID | 144811 |
| Cytogenetics | 13q14.11 |
| Summary | This gene encodes an oxidoreductase that promotes fatty-acid oxidation, with concomitant inflammasome activation, mitochondrial and NADPH-oxidase-dependent reactive oxygen species production, and bactericidal activity of macrophages. The encoded protein forms a complex with fatty acid synthase on peroxisomes and is thought to be modulated by peroxisome proliferator-activated receptor signaling events. Naturally occurring mutations in this gene are associated with inflammatory bowel disease, Behcet's disease, leprosy, ulcerative colitis, early-onset Crohn's disease, and systemic juvenile idiopathic arthritis. [provided by RefSeq, Apr 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407147 | LACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426942 | LACC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407147 | Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 2 |
CNY 3080.00 |
|
| LY426942 | Transient overexpression lysate of chromosome 13 open reading frame 31 (C13orf31), transcript variant 1 |
CNY 3080.00 |
|
| PH325705 | C13orf31 MS Standard C13 and N15-labeled recombinant protein (NP_001121775) |
CNY 19520.00 |
|
| TP307834 | Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325705 | Recombinant protein of human chromosome 13 open reading frame 31 (C13orf31), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C13orf31产品
