AHSP (NM_016633) Human Mass Spec Standard
CAT#: PH307743
AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717)
View other "AHSP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | AHSP MS Standard C13 and N15-labeled recombinant protein (NP_057717) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207743 |
| Predicted MW | 11.8 kDa |
| Protein Sequence |
>RC207743 protein sequence
Red=Cloning site Green=Tags(s) MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQEL RQELNTLANPFLAKYRDFLKSHELPSHPPPSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057717 |
| RefSeq Size | 518 |
| RefSeq ORF | 306 |
| Synonyms | EDRF; ERAF |
| Locus ID | 51327 |
| Cytogenetics | 16p11.2 |
| Summary | This gene encodes a molecular chaperone which binds specifically to free alpha-globin and is involved in hemoglobin assembly. The encoded protein binds to monomeric alpha-globin until it has been transferred to beta-globin to form a heterodimer, which in turn binds to another heterodimer to form the stable tetrameric hemoglobin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413883 | AHSP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413883 | Transient overexpression lysate of alpha hemoglobin stabilizing protein (AHSP) |
CNY 3080.00 |
|
| TP307743 | Recombinant protein of human erythroid associated factor (ERAF), 20 µg |
CNY 2900.00 |
