G CSF (CSF3) (NM_172220) Human Mass Spec Standard
CAT#: PH307709
CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374)
View other "G CSF" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207709 |
Predicted MW | 21.5 kDa |
Protein Sequence |
>RC207709 protein sequence
Red=Cloning site Green=Tags(s) MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHP EELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFA TTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_757374 |
RefSeq Size | 1494 |
RefSeq ORF | 600 |
Synonyms | C17orf33; CSF3OS; GCSF |
Locus ID | 1440 |
Cytogenetics | 17q21.1 |
Summary | This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400258 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403533 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432626 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400258 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1 |
CNY 3080.00 |
|
LY403533 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 3080.00 |
|
LY432626 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4 |
CNY 3080.00 |
|
PH317237 | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750) |
CNY 19520.00 |
|
TP307709 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP317237 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP329626 | Purified recombinant protein of Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP720002 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, produced in E. coli |
CNY 1800.00 |
|
TP723770 | Purified recombinant protein of Human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 5150.00 |