PRELP (NM_201348) Human Mass Spec Standard
CAT#: PH307609
PRELP MS Standard C13 and N15-labeled recombinant protein (NP_958505)
View other "PRELP" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | PRELP MS Standard C13 and N15-labeled recombinant protein (NP_958505) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207609 |
Predicted MW | 43.8 kDa |
Protein Sequence |
>RC207609 protein sequence
Red=Cloning site Green=Tags(s) MRSPLCWLLPLLILASVAQGQPTRRPRPGTGPGRRPRPRPRPTPSFPQPDEPAEPTDLPPPLPPGPPSIF PDCPRECYCPPDFPSALYCDSRNLRKVPVIPPRIHYLYLQNNFITELPVESFQNATGLRWINLDNNRIRK IDQRVLEKLPGLVFLYMEKNQLEEVPSALPRNLEQLRLSQNHISRIPPGVFSKLENLLLLDLQHNRLSDG VFKPDTFHGLKNLMQLNLAHNILRKMPPRVPTAIHQLYLDSNKIETIPNGYFKSFPNLAFIRLNYNKLTD RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVP HLRYLRLDGNYLKPPIPLDLMMCFRLLQSVVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_958505 |
RefSeq Size | 5823 |
RefSeq ORF | 1146 |
Synonyms | MST161; MSTP161; SLRR2A |
Locus ID | 5549 |
Cytogenetics | 1q32.1 |
Summary | The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400959 | PRELP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404518 | PRELP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400959 | Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 1 |
CNY 3080.00 |
|
LY404518 | Transient overexpression lysate of proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2 |
CNY 3080.00 |
|
TP307609 | Purified recombinant protein of Homo sapiens proline/arginine-rich end leucine-rich repeat protein (PRELP), transcript variant 2, 20 µg |
CNY 2900.00 |