SET (NM_003011) Human Mass Spec Standard
CAT#: PH307606
SET MS Standard C13 and N15-labeled recombinant protein (NP_003002)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SET MS Standard C13 and N15-labeled recombinant protein (NP_003002) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207606 |
| Predicted MW | 32.1 kDa |
| Protein Sequence |
>RC207606 protein sequence
Red=Cloning site Green=Tags(s) MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQK RSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLS KEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKD DIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003002 |
| RefSeq Size | 2936 |
| RefSeq ORF | 831 |
| Synonyms | 2PP2A; I2PP2A; IGAAD; IPP2A2; MRD58; PHAPII; TAF-I; TAF-IBETA |
| Locus ID | 6418 |
| Cytogenetics | 9q34.11 |
| Summary | The protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401059 | SET HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401059 | Transient overexpression lysate of SET nuclear oncogene (SET), transcript variant 2 |
CNY 3080.00 |
|
| TP307606 | Recombinant protein of human SET nuclear oncogene (SET), transcript variant 2, 20 µg |
CNY 2900.00 |
