liver FABP (FABP1) (NM_001443) Human Mass Spec Standard
CAT#: PH307592
FABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001434)
View other "liver FABP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001434) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207592 |
| Predicted MW | 14.2 kDa |
| Protein Sequence |
>RC207592 protein sequence
Red=Cloning site Green=Tags(s) MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECE LETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001434 |
| RefSeq Size | 598 |
| RefSeq ORF | 381 |
| Synonyms | FABPL; L-FABP |
| Locus ID | 2168 |
| Cytogenetics | 2p11.2 |
| Summary | This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011] |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400559 | FABP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400559 | Transient overexpression lysate of fatty acid binding protein 1, liver (FABP1) |
CNY 3080.00 |
|
| TP307592 | Recombinant protein of human fatty acid binding protein 1, liver (FABP1), 20 µg |
CNY 2900.00 |
|
| TP720114 | Recombinant protein of human fatty acid binding protein 1, liver (FABP1) |
CNY 1800.00 |
其它liver FABP产品
