FCER1G (NM_004106) Human Mass Spec Standard

Specifications

Product Data
Description	FCER1G MS Standard C13 and N15-labeled recombinant protein (NP_004097)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC207585
Predicted MW	9.8 kDa
Protein Sequence	Sequence Link (showhide) >Peptide sequence encoded by RC207585 Blue=ORF Red=Cloning site Green=Tag(s) MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGL STRNQETYETLKHEKPPQ myc-FLAG tag Recombinant protein using RC207585 also available, TP307585
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_004097
RefSeq Size	591
RefSeq ORF	261
Synonyms	FCRG
Locus ID	2207
Cytogenetics	1q23.3
Summary	The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
Protein Families	Transmembrane
Protein Pathways	Asthma, Fc epsilon RI signaling pathway, Natural killer cell mediated cytotoxicity

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.