MINPP1 (NM_004897) Human Mass Spec Standard
CAT#: PH307581
MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888)
View other "MINPP1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | MINPP1 MS Standard C13 and N15-labeled recombinant protein (NP_004888) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207581 |
Predicted MW | 54.9 kDa |
Protein Sequence |
>RC207581 representing NM_004897
Red=Cloning site Green=Tags(s) MLRAPGCLLRTSVAPAAALAAALLSSLARCSLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRD PELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYAD WMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPD VADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADL IQVAFFTCSFDLAIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKA VEQKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKKQMHRKFRSGLIVPYASNLIFVLY HCENAKTPKEQFRVQMLLNEKVLPLAYSQETVSFYEDLKNHYKDILQSCQTSEECELARANSTSDEL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004888 |
RefSeq Size | 2412 |
RefSeq ORF | 1461 |
Synonyms | HIPER1; MINPP2; MIPP |
Locus ID | 9562 |
Cytogenetics | 10q23.2 |
Summary | This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-BPG synthase/2-phosphatase (BPGM) in the Rapoport-Luebering shunt of the glycolytic pathway.[provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Inositol phosphate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417667 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432866 | MINPP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417667 | Transient overexpression lysate of multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1) |
CNY 3080.00 |
|
LY432866 | Transient overexpression lysate of multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2 |
CNY 3080.00 |
|
TP307581 | Recombinant protein of human multiple inositol polyphosphate histidine phosphatase, 1 (MINPP1), 20 µg |
CNY 2900.00 |
|
TP329866 | Purified recombinant protein of Homo sapiens multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP710176 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
TP720678 | Purified recombinant protein of Human multiple inositol-polyphosphate phosphatase 1 (MINPP1), transcript variant 1 |
CNY 1800.00 |