APJ Receptor (APLNR) (NM_005161) Human Mass Spec Standard
CAT#: PH307576
APLNR MS Standard C13 and N15-labeled recombinant protein (NP_005152)
View other "APJ Receptor" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | APLNR MS Standard C13 and N15-labeled recombinant protein (NP_005152) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207576 |
| Predicted MW | 42.7 kDa |
| Protein Sequence |
>RC207576 protein sequence
Red=Cloning site Green=Tags(s) MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH SQGPGPNMGKGGEQMHEKSIPYSQETLVVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005152 |
| RefSeq Size | 3905 |
| RefSeq ORF | 1140 |
| Synonyms | AGTRL1; APJ; APJR; HG11 |
| Locus ID | 187 |
| Cytogenetics | 11q12.1 |
| Summary | This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified. [provided by RefSeq, Jul 2009] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401579 | APLNR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401579 | Transient overexpression lysate of apelin receptor (APLNR), transcript variant 1 |
CNY 3080.00 |
|
| TP307576 | Recombinant protein of human apelin receptor (APLNR), 20 µg |
CNY 2900.00 |
其它APJ Receptor产品
