RNF41 (NM_194358) Human Mass Spec Standard
CAT＃: PH307568
RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339)
View other "RNF41" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | RNF41 MS Standard C13 and N15-labeled recombinant protein (NP_919339) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207568 |
| Predicted MW | 35.9 kDa |
| Protein Sequence |
>RC207568 protein sequence
Red=Cloning site Green=Tags(s) MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHLRPVPR IMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELPNHNCIKHLRS VVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYNEILEWVNSLQPAR VTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYYENYVAKRI PGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_919339 |
| RefSeq Size | 5420 |
| RefSeq ORF | 951 |
| Synonyms | FLRF; NRDP1; SBBI03 |
| Locus ID | 10193 |
| Cytogenetics | 12q13.3 |
| Summary | This gene encodes an E3 ubiquitin ligase. The encoded protein plays a role in type 1 cytokine receptor signaling by controlling the balance between JAK2-associated cytokine receptor degradation and ectodomain shedding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2011] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405109 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405110 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417072 | RNF41 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405109 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 2 |
CNY 3080.00 |
|
| LY405110 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 3 |
CNY 3080.00 |
|
| LY417072 | Transient overexpression lysate of ring finger protein 41 (RNF41), transcript variant 1 |
CNY 3080.00 |
|
| TP307568 | Recombinant protein of human ring finger protein 41 (RNF41), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760790 | Purified recombinant protein of Human ring finger protein 41 (RNF41), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
