IKZF3 (NM_012481) Human Mass Spec Standard
CAT＃: PH307547
IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_036613)
View other "IKZF3" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_036613) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207547 |
| Predicted MW | 58 kDa |
| Protein Sequence |
>RC207547 protein sequence
Red=Cloning site Green=Tags(s) MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPANEDEDIGDDSMKVKDEYSERDEN VLKSEPMGNAEEPEIPYSYSREYNEYENIKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSH TGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRS YKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEMGSERALVLDRLASNVAKRKSSMPQKFIGEKRH CFDVNYNSSYMYEKESELIQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRAE MSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQNHIYQQNHMVLSRARNGMPLLKE VPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSH DRYEFSSHIARGEHRALLK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036613 |
| RefSeq Size | 9686 |
| RefSeq ORF | 1527 |
| Synonyms | AIO; AIOLOS; ZNFN1A3 |
| Locus ID | 22806 |
| Cytogenetics | 17q12-q21.1 |
| Summary | This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This gene product is a transcription factor that is important in the regulation of B lymphocyte proliferation and differentiation. Both Ikaros and Aiolos can participate in chromatin remodeling. Regulation of gene expression in B lymphocytes by Aiolos is complex as it appears to require the sequential formation of Ikaros homodimers, Ikaros/Aiolos heterodimers, and Aiolos homodimers. Several alternative transcripts encoding different isoforms have been described, as well as some non-protein coding variants. [provided by RefSeq, Apr 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402225 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405188 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC405192 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC430651 | IKZF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402225 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1 |
CNY 3080.00 |
|
| LY405188 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 2 |
CNY 4840.00 |
|
| LY405192 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 |
CNY 4840.00 |
|
| LY430651 | Transient overexpression lysate of IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 6 |
CNY 3080.00 |
|
| PH319750 | IKZF3 MS Standard C13 and N15-labeled recombinant protein (NP_899054) |
CNY 14250.00 |
|
| TP307547 | Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP319750 | Recombinant protein of human IKAROS family zinc finger 3 (Aiolos) (IKZF3), transcript variant 5, 20 µg |
CNY 2900.00 |
