BST2 (NM_004335) Human Mass Spec Standard
CAT#: PH307540
BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)
View other "BST2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207540 |
| Predicted MW | 19.8 kDa |
| Protein Sequence |
>RC207540 protein sequence
Red=Cloning site Green=Tags(s) MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004326 |
| RefSeq Size | 1048 |
| RefSeq ORF | 540 |
| Synonyms | CD317; HM1.24; TETHERIN |
| Locus ID | 684 |
| Cytogenetics | 19p13.11 |
| Summary | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401380 | BST2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401380 | Transient overexpression lysate of bone marrow stromal cell antigen 2 (BST2) |
CNY 3080.00 |
|
| TP307540 | Recombinant protein of human bone marrow stromal cell antigen 2 (BST2), 20 µg |
CNY 2900.00 |

