GOLPH3 (NM_022130) Human Mass Spec Standard
CAT#: PH307477
GOLPH3 MS Standard C13 and N15-labeled recombinant protein (NP_071413)
View other "GOLPH3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | GOLPH3 MS Standard C13 and N15-labeled recombinant protein (NP_071413) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207477 |
| Predicted MW | 33.8 kDa |
| Protein Sequence |
>RC207477 protein sequence
Red=Cloning site Green=Tags(s) MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC LKANTNEVLWAVVAAFTK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_071413 |
| RefSeq Size | 2676 |
| RefSeq ORF | 894 |
| Synonyms | GOPP1; GPP34; MIDAS; Vps74 |
| Locus ID | 64083 |
| Cytogenetics | 5p13.3 |
| Summary | The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may have a regulatory role in Golgi trafficking. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of these variants has not been determined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411758 | GOLPH3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411758 | Transient overexpression lysate of golgi phosphoprotein 3 (coat-protein) (GOLPH3) |
CNY 3080.00 |
|
| TP307477 | Recombinant protein of human golgi phosphoprotein 3 (coat-protein) (GOLPH3), 20 µg |
CNY 2900.00 |
