FXYD1 (NM_005031) Human Mass Spec Standard
CAT#: PH307475
FXYD1 MS Standard C13 and N15-labeled recombinant protein (NP_005022)
View other "FXYD1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | FXYD1 MS Standard C13 and N15-labeled recombinant protein (NP_005022) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207475 |
| Predicted MW | 10.4 kDa |
| Protein Sequence |
>RC207475 protein sequence
Red=Cloning site Green=Tags(s) MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRT GEPDEEEGTFRSSIRRLSTRRR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005022 |
| RefSeq Size | 599 |
| RefSeq ORF | 276 |
| Synonyms | PLM |
| Locus ID | 5348 |
| Cytogenetics | 19q13.12 |
| Summary | This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature. [provided by RefSeq, Jul 2008] |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402884 | FXYD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417593 | FXYD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402884 | Transient overexpression lysate of FXYD domain containing ion transport regulator 1 (FXYD1), transcript variant b |
CNY 3080.00 |
|
| LY417593 | Transient overexpression lysate of FXYD domain containing ion transport regulator 1 (FXYD1), transcript variant a |
CNY 3080.00 |
|
| TP307475 | Recombinant protein of human FXYD domain containing ion transport regulator 1 (FXYD1), transcript variant a, 20 µg |
CNY 2900.00 |
