FNDC4 (NM_022823) Human Mass Spec Standard
CAT#: PH307471
FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734)
View other "FNDC4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FNDC4 MS Standard C13 and N15-labeled recombinant protein (NP_073734) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207471 |
| Predicted MW | 25.2 kDa |
| Protein Sequence |
>RC207471 protein sequence
Red=Cloning site Green=Tags(s) MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVP EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKG SDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGP EQSPQGRPVGTRQKKSPSINTIDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_073734 |
| RefSeq Size | 1697 |
| RefSeq ORF | 702 |
| Synonyms | FRCP1 |
| Locus ID | 64838 |
| Cytogenetics | 2p23.3 |
| Summary | Acts as an anti-inflammatory factor in the intestine and colon. Binds to and acts on macrophages to downregulate pro-inflammatory gene expression. Affects key macrophage functions, including phagocytosis, by downregulating many key pathways for macrophage activation, partly via by STAT3 activation and signaling. May be required to dampen the immunological response in colitis.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411537 | FNDC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411537 | Transient overexpression lysate of fibronectin type III domain containing 4 (FNDC4) |
CNY 3080.00 |
|
| TP307471 | Recombinant protein of human fibronectin type III domain containing 4 (FNDC4), 20 µg |
CNY 2900.00 |
