CPA5 (NM_080385) Human Mass Spec Standard
CAT#: PH307397
CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124)
View other "CPA5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CPA5 MS Standard C13 and N15-labeled recombinant protein (NP_525124) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207397 |
| Predicted MW | 49 kDa |
| Protein Sequence |
>RC207397 protein sequence
Red=Cloning site Green=Tags(s) MQGTPGGGTRPGPSPVDRRTLLVFSFILAAALGQMNFTGDQVLRVLAKDEKQLSLLGDLEGLKPQKVDFW RGPARPSLPVDMRVPFSELKDIKAYLESHGLAYSIMIKDIQVLLDEERQAMAKSRRLERSTNSFSYSSYH TLEEIYSWIDNFVMEHSDIVSKIQIGNSFENQSILVLKFSTGGSRHPAIWIDTGIHSREWITHATGIWTA NKIVSDYGKDRVLTDILNAMDIFIELVTNPDGFAFTHSMNRLWRKNKSIRPGIFCIGVDLNRNWKSGFGG NGSNSNPCSETYHGPSPQSEPEVAAIVNFITAHGNFKALISIHSYSQMLMYPYGRSLDPVSNQRELYDLA KDAVEALYKVHGIEYIFGSISTTLYVASGITVDWAYDSGIKYAFSFELRDTGQYGFLLPATQIIPTAQET WMALRTIMEHTLNHPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_525124 |
| RefSeq Size | 2078 |
| RefSeq ORF | 1308 |
| Locus ID | 93979 |
| Cytogenetics | 7q32.2 |
| Summary | Carboxypeptidases have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Members of the A/B subfamily of carboxypeptidases, such as CPA5, contain an approximately 90-amino acid pro region that assists in the folding of the active carboxypeptidase domain. Cleavage of the pro region activates the enzyme (Wei et al., 2002 [PubMed 11836249]).[supplied by OMIM, Mar 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409210 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426784 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426785 | CPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409210 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 1 |
CNY 3080.00 |
|
| LY426784 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 2 |
CNY 3080.00 |
|
| LY426785 | Transient overexpression lysate of carboxypeptidase A5 (CPA5), transcript variant 3 |
CNY 3080.00 |
|
| TP307397 | Recombinant protein of human carboxypeptidase A5 (CPA5), transcript variant 1, 20 µg |
CNY 2900.00 |
