Kv beta 1 (KCNAB1) (NM_172159) Human Mass Spec Standard
CAT#: PH307384
KCNAB1 MS Standard C13 and N15-labeled recombinant protein (NP_751891)
View other "Kv beta 1" proteins (10)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | KCNAB1 MS Standard C13 and N15-labeled recombinant protein (NP_751891) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207384 |
Predicted MW | 44.7 kDa |
Protein Sequence |
>RC207384 protein sequence
Red=Cloning site Green=Tags(s) MQVSIACTEHNLKSRNGEDRLLSKQSSTAPNVVNAARAKFRTVAIIARSLGTFTPQHHISLKESTAKQTG MKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKK GWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHV INQGMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPL ACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEG VSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_751891 |
RefSeq Size | 4518 |
RefSeq ORF | 1203 |
Synonyms | AKR6A3; hKvb3; hKvBeta3; KCNA1B; KV-BETA-1; Kvb1.3 |
Locus ID | 7881 |
Cytogenetics | 3q25.31 |
Summary | Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member includes distinct isoforms which are encoded by alternatively spliced transcript variants of this gene. Some of these isoforms are beta subunits, which form heteromultimeric complexes with alpha subunits and modulate the activity of the pore-forming alpha subunits. [provided by RefSeq, Apr 2015] |
Protein Families | Druggable Genome, Ion Channels: Other |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403531 | KCNAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406773 | KCNAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC418655 | KCNAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429147 | KCNAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430344 | KCNAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403531 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 3 |
CNY 3080.00 |
|
LY406773 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 1 |
CNY 4840.00 |
|
LY418655 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 2 |
CNY 3080.00 |
|
LY430344 | Transient overexpression lysate of potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 1 |
CNY 3080.00 |
|
TP307384 | Recombinant protein of human potassium voltage-gated channel, shaker-related subfamily, beta member 1 (KCNAB1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Kv beta 1产品