UBE2D3 (NM_003340) Human Mass Spec Standard
CAT#: PH307371
UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331)
View other "UBE2D3" proteins (26)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_003331) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207371 |
| Predicted MW | 16.7 kDa |
| Protein Sequence |
>RC207371 protein sequence
Red=Cloning site Green=Tags(s) MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISRE WTQKYAM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003331 |
| RefSeq Size | 3976 |
| RefSeq ORF | 441 |
| Synonyms | E2(17)KB3; UBC4/5; UBCH5C |
| Locus ID | 7323 |
| Cytogenetics | 4q24 |
| Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. [provided by RefSeq, Jan 2017] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405574 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405575 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405576 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405577 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405578 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405579 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405581 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418758 | UBE2D3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405574 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2 |
CNY 3080.00 |
|
| LY405575 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3 |
CNY 3080.00 |
|
| LY405576 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 4 |
CNY 3080.00 |
|
| LY405577 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5 |
CNY 3080.00 |
|
| LY405578 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 6 |
CNY 3080.00 |
|
| LY405579 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 7 |
CNY 3080.00 |
|
| LY405581 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9 |
CNY 3080.00 |
|
| LY418758 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1 |
CNY 3080.00 |
|
| PH313585 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871615) |
CNY 14250.00 |
|
| PH313686 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871618) |
CNY 14250.00 |
|
| PH315841 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871616) |
CNY 19520.00 |
|
| PH318977 | UBE2D3 MS Standard C13 and N15-labeled recombinant protein (NP_871622) |
CNY 19520.00 |
|
| TP307371 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP313585 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP313686 | Purified recombinant protein of Homo sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP315841 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP318977 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) (UBE2D3), transcript variant 9, 20 µg |
CNY 2900.00 |
|
| TP721151 | Purified recombinant protein of Human ubiquitin-conjugating enzyme E2D 3 (UBE2D3), transcript variant 1 |
CNY 1800.00 |
