LZTFL1 (NM_020347) Human Mass Spec Standard
CAT#: PH307289
LZTFL1 MS Standard C13 and N15-labeled recombinant protein (NP_065080)
View other "LZTFL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LZTFL1 MS Standard C13 and N15-labeled recombinant protein (NP_065080) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207289 |
Predicted MW | 34.6 kDa |
Protein Sequence |
>RC207289 protein sequence
Red=Cloning site Green=Tags(s) MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVE SELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAP LNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSN LENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTK KNDQIKDLRKRLAQYEPED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_065080 |
RefSeq Size | 4075 |
RefSeq ORF | 897 |
Synonyms | BBS17 |
Locus ID | 54585 |
Cytogenetics | 3p21.31 |
Summary | This gene encodes a ubiquitously expressed protein that localizes to the cytoplasm. This protein interacts with Bardet-Biedl Syndrome (BBS) proteins and, through its interaction with BBS protein complexes, regulates protein trafficking to the ciliary membrane. Nonsense mutations in this gene cause a form of Bardet-Biedl Syndrome; a ciliopathy characterized in part by polydactyly, obesity, cognitive impairment, hypogonadism, and kidney failure. This gene may also function as a tumor suppressor; possibly by interacting with E-cadherin and the actin cytoskeleton and thereby regulating the transition of epithelial cells to mesenchymal cells. [provided by RefSeq, Aug 2020] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412543 | LZTFL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412543 | Transient overexpression lysate of leucine zipper transcription factor-like 1 (LZTFL1) |
CNY 3080.00 |
|
TP307289 | Recombinant protein of human leucine zipper transcription factor-like 1 (LZTFL1), 20 µg |
CNY 2900.00 |