UBE2D2 (NM_181838) Human Mass Spec Standard
CAT＃: PH307283
UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821)
View other "UBE2D2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_862821) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207283 |
| Predicted MW | 13.5 kDa |
| Protein Sequence |
>RC207283 representing NM_181838
Red=Cloning site Green=Tags(s) MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIARE WTQKYAM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_862821 |
| RefSeq Size | 2879 |
| RefSeq ORF | 441 |
| Synonyms | E2(17)KB2; PUBC1; UBC4; UBC4/5; UBCH4; UBCH5B |
| Locus ID | 7322 |
| Cytogenetics | 5q31.2 |
| Summary | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013] |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405611 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418757 | UBE2D2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405611 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2 |
CNY 3080.00 |
|
| LY418757 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1 |
CNY 3080.00 |
|
| PH318795 | UBE2D2 MS Standard C13 and N15-labeled recombinant protein (NP_003330) |
CNY 19520.00 |
|
| TP307283 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318795 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 1, 20 µg |
CNY 2900.00 |
Recombinant protein of human ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) (UBE2D2), transcript variant 2, 100 µg
