UPP2 (NM_173355) Human Mass Spec Standard
CAT#: PH307260
UPP2 MS Standard C13 and N15-labeled recombinant protein (NP_775491)
View other "UPP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UPP2 MS Standard C13 and N15-labeled recombinant protein (NP_775491) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207260 |
| Predicted MW | 35.5 kDa |
| Protein Sequence |
>RC207260 protein sequence
Red=Cloning site Green=Tags(s) MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_775491 |
| RefSeq Size | 2413 |
| RefSeq ORF | 951 |
| Synonyms | UDRPASE2; UP2; UPASE2 |
| Locus ID | 151531 |
| Cytogenetics | 2q24.1 |
| Summary | Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis. Shows substrate specificity and accept uridine, deoxyuridine, and thymidine as well as the two pyrimidine nucleoside analogs 5-fluorouridine and 5-fluoro-2(')-deoxyuridine as substrates.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406610 | UPP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406610 | Transient overexpression lysate of uridine phosphorylase 2 (UPP2), transcript variant 1 |
CNY 3080.00 |
|
| TP307260 | Recombinant protein of human uridine phosphorylase 2 (UPP2), transcript variant 1, 20 µg |
CNY 2900.00 |
