GCLM (NM_002061) Human Mass Spec Standard
CAT#: PH307224
GCLM MS Standard C13 and N15-labeled recombinant protein (NP_002052)
View other "GCLM" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GCLM MS Standard C13 and N15-labeled recombinant protein (NP_002052) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207224 |
| Predicted MW | 30.7 kDa |
| Protein Sequence |
>RC207224 protein sequence
Red=Cloning site Green=Tags(s) MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINPDLVREFPDVL ECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVAQLDSVIIASPPIEDGVNLSL EHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQ LLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002052 |
| RefSeq Size | 3074 |
| RefSeq ORF | 822 |
| Synonyms | GLCLR |
| Locus ID | 2730 |
| Cytogenetics | 1p22.1 |
| Summary | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015] |
| Protein Families | Druggable Genome |
| Protein Pathways | Glutathione metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400752 | GCLM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400752 | Transient overexpression lysate of glutamate-cysteine ligase, modifier subunit (GCLM) |
CNY 3080.00 |
|
| TP307224 | Recombinant protein of human glutamate-cysteine ligase, modifier subunit (GCLM), 20 µg |
CNY 2900.00 |
