FHIT (NM_002012) Human Mass Spec Standard
CAT#: PH307120
FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003)
View other "FHIT" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | FHIT MS Standard C13 and N15-labeled recombinant protein (NP_002003) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207120 |
| Predicted MW | 16.9 kDa |
| Protein Sequence |
>RC207120 protein sequence
Red=Cloning site Green=Tags(s) MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVE KHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAA ALRVYFQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002003 |
| RefSeq Size | 1103 |
| RefSeq ORF | 441 |
| Synonyms | AP3Aase; FRA3B |
| Locus ID | 2272 |
| Cytogenetics | 3p14.2 |
| Summary | The protein encoded by this gene is a P1-P3-bis(5'-adenosyl) triphosphate hydrolase involved in purine metabolism. This gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. The encoded protein is also a tumor suppressor, as loss of its activity results in replication stress and DNA damage. [provided by RefSeq, Aug 2017] |
| Protein Pathways | Non-small cell lung cancer, Purine metabolism, Small cell lung cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419588 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431768 | FHIT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419588 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 1 |
CNY 3080.00 |
|
| LY431768 | Transient overexpression lysate of fragile histidine triad gene (FHIT), transcript variant 2 |
CNY 3080.00 |
|
| TP307120 | Recombinant protein of human fragile histidine triad gene (FHIT), 20 µg |
CNY 2900.00 |
|
| TP328740 | Recombinant protein of human fragile histidine triad gene (FHIT), transcript variant 2, 20 µg |
CNY 2900.00 |
