RAB39 (RAB39A) (NM_017516) Human Mass Spec Standard
CAT#: PH307062
RAB39 MS Standard C13 and N15-labeled recombinant protein (NP_059986)
View other "RAB39" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RAB39 MS Standard C13 and N15-labeled recombinant protein (NP_059986) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207062 |
| Predicted MW | 25 kDa |
| Protein Sequence |
>RC207062 protein sequence
Red=Cloning site Green=Tags(s) METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTA GQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTRE EAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVK PRKECFC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_059986 |
| RefSeq Size | 1845 |
| RefSeq ORF | 651 |
| Synonyms | RAB39 |
| Locus ID | 54734 |
| Cytogenetics | 11q22.3 |
| Summary | Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K (PubMed:24349490). May be involved in multiple neurite formation (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402595 | RAB39A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402595 | Transient overexpression lysate of RAB39, member RAS oncogene family (RAB39) |
CNY 3080.00 |
|
| TP307062 | Recombinant protein of human RAB39, member RAS oncogene family (RAB39), 20 µg |
CNY 2900.00 |
