NUP50 (NM_153645) Human Mass Spec Standard
CAT#: PH307001
NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931)
View other "NUP50" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_705931) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207001 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC207001 protein sequence
Red=Cloning site Green=Tags(s) MASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGGGRFSGFGSGAGGKPLEGLSNGNNITSAP PFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVR DWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSESESNKVAAETQSPSLFGSTKLQQESTFLF HGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSSVLGSLSSVPLTGFSFSPGNSSLFGKDTT QSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGI GTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIR VKTSEDADELHKILLEKKDA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_705931 |
RefSeq Size | 5051 |
RefSeq ORF | 1320 |
Synonyms | NPAP60; NPAP60L |
Locus ID | 10762 |
Cytogenetics | 22q13.31 |
Summary | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407000 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416145 | NUP50 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407000 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 3 |
CNY 3080.00 |
|
LY416145 | Transient overexpression lysate of nucleoporin 50kDa (NUP50), transcript variant 2 |
CNY 3080.00 |
|
PH309975 | NUP50 MS Standard C13 and N15-labeled recombinant protein (NP_009103) |
CNY 19520.00 |
|
TP307001 | Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP309975 | Recombinant protein of human nucleoporin 50kDa (NUP50), transcript variant 2, 20 µg |
CNY 2900.00 |