HPD (NM_002150) Human Mass Spec Standard
CAT#: PH306860
HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HPD MS Standard C13 and N15-labeled recombinant protein (NP_002141) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206860 |
| Predicted MW | 44.9 kDa |
| Protein Sequence |
>RC206860 protein sequence
Red=Cloning site Green=Tags(s) MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFV LSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVLQTYG DTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFW SVDDTQVHTEYSSLRSIVVANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKGYLLQIFTKPVQDRPTLFLEV IQRHNHQGFGAGNFNSLFKAFEEEQNLRGNLTNMETNGVVPGM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002141 |
| RefSeq Size | 1440 |
| RefSeq ORF | 1179 |
| Synonyms | 4-HPPD; 4HPPD; GLOD3; HPPDASE; PPD |
| Locus ID | 3242 |
| Cytogenetics | 12q24.31 |
| Summary | The protein encoded by this gene is an enzyme in the catabolic pathway of tyrosine. The encoded protein catalyzes the conversion of 4-hydroxyphenylpyruvate to homogentisate. Defects in this gene are a cause of tyrosinemia type 3 (TYRO3) and hawkinsinuria (HAWK). Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Phenylalanine metabolism, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419503 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432928 | HPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419503 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 1 |
CNY 3080.00 |
|
| LY432928 | Transient overexpression lysate of 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2 |
CNY 3080.00 |
|
| TP306860 | Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), 20 µg |
CNY 2900.00 |
|
| TP720550 | Recombinant protein of human 4-hydroxyphenylpyruvate dioxygenase (HPD), transcript variant 2. |
CNY 1800.00 |
