GRB10 (NM_001001555) Human Mass Spec Standard
CAT#: PH306853
GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555)
View other "GRB10" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001555) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206853 |
| Predicted MW | 60.8 kDa |
| Protein Sequence |
>RC206853 protein sequence
Red=Cloning site Green=Tags(s) MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQ QFRTSSLPAIPNPFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLV YKSHCVDDNSWTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVT WCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLAD LEDSNIFSLIAGRKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPL HPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCE DDGQTFFSLDDGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001001555 |
| RefSeq Size | 5040 |
| RefSeq ORF | 1608 |
| Synonyms | Grb-10; GRB-IR; IRBP; MEG1; RSS |
| Locus ID | 2887 |
| Cytogenetics | 7p12.1 |
| Summary | The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with insulin receptors and insulin-like growth-factor receptors. Overexpression of some isoforms of the encoded protein inhibits tyrosine kinase activity and results in growth suppression. This gene is imprinted in a highly isoform- and tissue-specific manner, with expression observed from the paternal allele in the brain, and from the maternal allele in the placental trophoblasts. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417385 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424374 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424375 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424378 | GRB10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417385 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 1 |
CNY 4840.00 |
|
| LY424374 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 2 |
CNY 4840.00 |
|
| LY424375 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 3 |
CNY 4840.00 |
|
| LY424378 | Transient overexpression lysate of growth factor receptor-bound protein 10 (GRB10), transcript variant 4 |
CNY 3080.00 |
|
| PH320822 | GRB10 MS Standard C13 and N15-labeled recombinant protein (NP_001001550) |
CNY 19520.00 |
|
| TP306853 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP320822 | Recombinant protein of human growth factor receptor-bound protein 10 (GRB10), transcript variant 3, 20 µg |
CNY 2900.00 |
