GNAI3 (NM_006496) Human Mass Spec Standard
CAT#: PH306850
GNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_006487)
View other "GNAI3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | GNAI3 MS Standard C13 and N15-labeled recombinant protein (NP_006487) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206850 |
| Predicted MW | 40.5 kDa |
| Protein Sequence |
>RC206850 protein sequence
Red=Cloning site Green=Tags(s) MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYK VVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLWRDGGVQACF SRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKK WIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKR SPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKE CGLY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006487 |
| RefSeq Size | 4748 |
| RefSeq ORF | 1062 |
| Synonyms | 87U6; ARCND1 |
| Locus ID | 2773 |
| Cytogenetics | 1p13.3 |
| Summary | Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling pathways. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes an alpha subunit and belongs to the G-alpha family. Mutation in this gene, resulting in a gly40-to-arg substitution, is associated with auriculocondylar syndrome, and shown to affect downstream targets in the G protein-coupled endothelin receptor pathway. [provided by RefSeq, Jun 2012] |
| Protein Families | Druggable Genome |
| Protein Pathways | Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401948 | GNAI3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401948 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3) |
CNY 3080.00 |
|
| TP306850 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 (GNAI3), 20 µg |
CNY 2900.00 |
