RBFOX2 (NM_001031695) Human Mass Spec Standard
CAT#: PH306846
RBM9 MS Standard C13 and N15-labeled recombinant protein (NP_001026865)
View other "RBFOX2" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | RBM9 MS Standard C13 and N15-labeled recombinant protein (NP_001026865) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206846 |
Predicted MW | 40.4 kDa |
Protein Sequence |
>RC206846 protein sequence
Red=Cloning site Green=Tags(s) MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGE QSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVG AVYGPELYAASSFQADVSLGNDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGR TVYGAVRAVPPTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD PYHALAPAASYGVGAVASLYRGGYSRFAPY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001026865 |
RefSeq Size | 6997 |
RefSeq ORF | 1140 |
Synonyms | dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA |
Locus ID | 23543 |
Cytogenetics | 22q12.3 |
Summary | This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415365 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421191 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421192 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421906 | RBFOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415365 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 2 |
CNY 3080.00 |
|
LY421191 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 3 |
CNY 3080.00 |
|
LY421192 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 4 |
CNY 3080.00 |
|
LY421906 | Transient overexpression lysate of RNA binding motif protein 9 (RBM9), transcript variant 1 |
CNY 3080.00 |
|
TP306846 | Purified recombinant protein of Homo sapiens RNA binding motif protein 9 (RBM9), transcript variant 1, 20 µg |
CNY 2900.00 |