ATP6V1H (NM_015941) Human Mass Spec Standard
CAT＃: PH306841
ATP6V1H MS Standard C13 and N15-labeled recombinant protein (NP_057025)
View other "ATP6V1H" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ATP6V1H MS Standard C13 and N15-labeled recombinant protein (NP_057025) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206841 |
| Predicted MW | 55.9 kDa |
| Protein Sequence |
>RC206841 protein sequence
Red=Cloning site Green=Tags(s) MTKMDIRGAVDAAVPTNIIAAKAAEVRANKVNWQSYLQGQMISAEDCEFIQRFEMKRSPEEKQEMLQTEG SQCAKTFINLMTHICKEQTVQYILTMVDDMLQENHQRVSIFFDYARCSKNTAWPYFLPMLNRQDPFTVHM AARIIAKLAAWGKELMEGSDLNYYFNWIKTQLSSQKLRGSGVAVETGTVSSSDSSQYVQCVAGCLQLMLR VNEYRFAWVEADGVNCIMGVLSNKCGFQLQYQMIFSIWLLAFSPQMCEHLRRYNIIPVLSDILQESVKEK VTRIILAAFRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDLS SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVAAHDVGEYVRH YPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSEQPQTAAARS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_057025 |
| RefSeq Size | 2186 |
| RefSeq ORF | 1449 |
| Synonyms | CGI-11; MSTP042; NBP1; SFD; SFDalpha; SFDbeta; VMA13 |
| Locus ID | 51606 |
| Cytogenetics | 8q11.23 |
| Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular organelles. V-ATPase-dependent organelle acidification is necessary for multiple processes including protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. The encoded protein is the regulatory H subunit of the V1 domain of V-ATPase, which is required for catalysis of ATP but not the assembly of V-ATPase. Decreased expression of this gene may play a role in the development of type 2 diabetes. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
| Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403891 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC403892 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC414295 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431017 | ATP6V1H HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403891 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 2 |
CNY 4840.00 |
|
| LY403892 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 3 |
CNY 4840.00 |
|
| LY414295 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 1 |
CNY 3080.00 |
|
| TP306841 | Recombinant protein of human ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H (ATP6V1H), transcript variant 1, 20 µg |
CNY 2900.00 |
其它ATP6V1H产品
