MRFAP1 (NM_033296) Human Mass Spec Standard
CAT#: PH306815
MRFAP1 MS Standard C13 and N15-labeled recombinant protein (NP_150638)
View other "MRFAP1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRFAP1 MS Standard C13 and N15-labeled recombinant protein (NP_150638) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206815 |
| Predicted MW | 14.6 kDa |
| Protein Sequence |
>RC206815 protein sequence
Red=Cloning site Green=Tags(s) MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_150638 |
| RefSeq Size | 2184 |
| RefSeq ORF | 381 |
| Synonyms | PAM14; PGR1 |
| Locus ID | 93621 |
| Cytogenetics | 4p16.1 |
| Summary | This gene encodes an intracellular protein that interacts with members of the MORF4/MRG (mortality factor on chromosome 4/MORF4 related gene) family and the tumor suppressor Rb (retinoblastoma protein.) The protein may play a role in senescence, cell growth and immortalization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409615 | MRFAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409615 | Transient overexpression lysate of Mof4 family associated protein 1 (MRFAP1) |
CNY 3080.00 |
|
| TP306815 | Recombinant protein of human Mof4 family associated protein 1 (MRFAP1), 20 µg |
CNY 2900.00 |
