DUSP6 (NM_001946) Human Mass Spec Standard
CAT#: PH306765
DUSP6 MS Standard C13 and N15-labeled recombinant protein (NP_001937)
View other "DUSP6" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DUSP6 MS Standard C13 and N15-labeled recombinant protein (NP_001937) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206765 |
Predicted MW | 42.3 kDa |
Protein Sequence |
>RC206765 protein sequence
Red=Cloning site Green=Tags(s) MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGN LPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLKKLKDEGCRAFYLEGGFSKFQ AEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEI LPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFID EARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLS SPCDNRVPAQQLYFTTPSNQNVYQVDSLQST myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001937 |
RefSeq Size | 3395 |
RefSeq ORF | 1143 |
Synonyms | HH19; MKP3; PYST1 |
Locus ID | 1848 |
Cytogenetics | 12q21.33 |
Summary | The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Mutations in this gene have been associated with congenital hypogonadotropic hypogonadism. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419629 | DUSP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419629 | Transient overexpression lysate of dual specificity phosphatase 6 (DUSP6), transcript variant 1 |
CNY 3080.00 |
|
TP306765 | Recombinant protein of human dual specificity phosphatase 6 (DUSP6), transcript variant 1, 20 µg |
CNY 2900.00 |