PHLDA3 (NM_012396) Human Mass Spec Standard
CAT#: PH306751
PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528)
View other "PHLDA3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PHLDA3 MS Standard C13 and N15-labeled recombinant protein (NP_036528) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206751 |
| Predicted MW | 13.9 kDa |
| Protein Sequence |
>RC206751 protein sequence
Red=Cloning site Green=Tags(s) MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRH IYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036528 |
| RefSeq Size | 1516 |
| RefSeq ORF | 381 |
| Synonyms | TIH1 |
| Locus ID | 23612 |
| Cytogenetics | 1q32.1 |
| Summary | p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415793 | PHLDA3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415793 | Transient overexpression lysate of pleckstrin homology-like domain, family A, member 3 (PHLDA3) |
CNY 3080.00 |
|
| TP306751 | Recombinant protein of human pleckstrin homology-like domain, family A, member 3 (PHLDA3), 20 µg |
CNY 2900.00 |
