E3 SUMO protein ligase PIAS4 (PIAS4) (NM_015897) Human Mass Spec Standard
CAT#: PH306748
PIAS4 MS Standard C13 and N15-labeled recombinant protein (NP_056981)
View other "E3 SUMO protein ligase PIAS4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PIAS4 MS Standard C13 and N15-labeled recombinant protein (NP_056981) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206748 |
| Predicted MW | 56.5 kDa |
| Protein Sequence |
>RC206748 protein sequence
Red=Cloning site Green=Tags(s) MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKELYETRYAKKN SEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFN MLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPP NIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLT SSELLQRLKTIGVKHPELCKALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDA VFYLQMNEKKPTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEEEEEEEEEDED EEGPRPKRRCPFQKGLVPAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056981 |
| RefSeq Size | 1835 |
| RefSeq ORF | 1530 |
| Synonyms | PIAS-gamma; Piasg; PIASY; ZMIZ6 |
| Locus ID | 51588 |
| Cytogenetics | 19p13.3 |
| Summary | Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53/TP53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Mediates sumoylation of CEBPA, PARK7, HERC2, MYB, TCF4 and RNF168. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
| Protein Pathways | Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414329 | PIAS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414329 | Transient overexpression lysate of protein inhibitor of activated STAT, 4 (PIAS4) |
CNY 3080.00 |
|
| TP306748 | Recombinant protein of human protein inhibitor of activated STAT, 4 (PIAS4), 20 µg |
CNY 2900.00 |
其它E3 SUMO protein ligase PIAS4产品
