ARH (LDLRAP1) (NM_015627) Human Mass Spec Standard
CAT#: PH306643
LDLRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056442)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | LDLRAP1 MS Standard C13 and N15-labeled recombinant protein (NP_056442) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206643 |
| Predicted MW | 33.7 kDa |
| Protein Sequence |
>RC206643 representing NM_015627
Red=Cloning site Green=Tags(s) MDALKSAGRALIRSPSLAKQSWGGGGRHRKLPENWTDTRETLLEGMLFSLKYLGMTLVEQPKGEELSAAA IKRIVATAKASGKKLQKVTLKVSPRGIILTDNLTNQLIENVSIYRISYCTADKMHDKVFAYIAQSQHNQS LECHAFLCTKRKMAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPPLKSLVATG NLLDLEETAKAPLSTVSANTTNMDEVPRPQALSGSSVVWELDDGLDEAFSRLAQSRTNPQVLDTGLTAQD MHYAQCLSPVDWDKPDSSGTEQDDLFSF TRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056442 |
| RefSeq Size | 2862 |
| RefSeq ORF | 924 |
| Synonyms | ARH; ARH1; ARH2; FHCB1; FHCB2; FHCL4 |
| Locus ID | 26119 |
| Cytogenetics | 1p36.11 |
| Summary | The protein encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414462 | LDLRAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414462 | Transient overexpression lysate of low density lipoprotein receptor adaptor protein 1 (LDLRAP1) |
CNY 3080.00 |
|
| TP306643 | Recombinant protein of human low density lipoprotein receptor adaptor protein 1 (LDLRAP1), 20 µg |
CNY 2900.00 |
