CD2 (NM_001767) Human Mass Spec Standard
CAT#: PH306612
CD2 MS Standard C13 and N15-labeled recombinant protein (NP_001758)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 14250.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | CD2 MS Standard C13 and N15-labeled recombinant protein (NP_001758) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC206612 | 
| Predicted MW | 39.4 kDa | 
| Protein Sequence | 
                 >RC206612 protein sequence 
Red=Cloning site Green=Tags(s) MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQ FRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCI NTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDI YLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPQQIPASTPQNPATSQ HPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSS N myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_001758 | 
| RefSeq Size | 1595 | 
| RefSeq ORF | 1053 | 
| Synonyms | LFA-2; SRBC; T11 | 
| Locus ID | 914 | 
| Cytogenetics | 1p13.1 | 
| Summary | The protein encoded by this gene is a surface antigen found on all peripheral blood T-cells. The encoded protein interacts with LFA3 (CD58) on antigen presenting cells to optimize immune recognition. A locus control region (LCR) has been found in the 3' flanking sequence of this gene. [provided by RefSeq, Jun 2016] | 
| Protein Families | Druggable Genome, Transmembrane | 
| Protein Pathways | Cell adhesion molecules (CAMs), Hematopoietic cell lineage | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400671 | CD2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400671 | Transient overexpression lysate of CD2 molecule (CD2) | 
                                                     CNY 3080.00  | 
                                            |
| TP306612 | Purified recombinant protein of Homo sapiens CD2 molecule (CD2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            |
| TP700239 | Purified recombinant protein of human CD2 molecule (CD2), with C-terminal DDK/His tag, expressed in human cells, 20 µg | 
                                                     CNY 6650.00  | 
                                            |
| TP721123 | Purified recombinant protein of Human CD2 molecule (CD2) | 
                                                     CNY 1800.00  | 
                                            |
| TP761130 | Purified recombinant protein of Human CD2 molecule (CD2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug | 
                                                     CNY 2040.00  | 
                                            
