CD89 (FCAR) (NM_002000) Human Mass Spec Standard
CAT＃: PH306601
FCAR MS Standard C13 and N15-labeled recombinant protein (NP_001991)
View other "CD89" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | FCAR MS Standard C13 and N15-labeled recombinant protein (NP_001991) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206601 |
| Predicted MW | 32.3 kDa |
| Protein Sequence |
>RC206601 protein sequence
Red=Cloning site Green=Tags(s) MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE IGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGE NISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNA LELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFA RTPSVCK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001991 |
| RefSeq Size | 1671 |
| RefSeq ORF | 861 |
| Synonyms | CD89; CTB-61M7.2; FcalphaRI |
| Locus ID | 2204 |
| Cytogenetics | 19q13.42 |
| Summary | This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408857 | FCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408859 | FCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408862 | FCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419604 | FCAR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408857 | Transient overexpression lysate of Fc fragment of IgA, receptor for (FCAR), transcript variant 2 |
CNY 3080.00 |
|
| LY408859 | Transient overexpression lysate of Fc fragment of IgA, receptor for (FCAR), transcript variant 4 |
CNY 3080.00 |
|
| LY408862 | Transient overexpression lysate of Fc fragment of IgA, receptor for (FCAR), transcript variant 7 |
CNY 3080.00 |
|
| LY419604 | Transient overexpression lysate of Fc fragment of IgA, receptor for (FCAR), transcript variant 1 |
CNY 3080.00 |
|
| TP306601 | Recombinant protein of human Fc fragment of IgA, receptor for (FCAR), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720394 | Recombinant protein of human Fc fragment of IgA, receptor for (FCAR), transcript variant 1 |
CNY 1800.00 |
|
| TP761873 | Purified recombinant protein of Human Fc fragment of IgA, receptor for (FCAR), transcript variant 2, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
