Exodus 2 (CCL21) (NM_002989) Human Mass Spec Standard
CAT#: PH306579
CCL21 MS Standard C13 and N15-labeled recombinant protein (NP_002980)
View other "Exodus 2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CCL21 MS Standard C13 and N15-labeled recombinant protein (NP_002980) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206579 |
| Predicted MW | 14.6 kDa |
| Protein Sequence |
>RC206579 protein sequence
Red=Cloning site Green=Tags(s) MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRS QAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002980 |
| RefSeq Size | 913 |
| RefSeq ORF | 402 |
| Synonyms | 6Ckine; CKb9; ECL; SCYA21; SLC; TCA4 |
| Locus ID | 6366 |
| Cytogenetics | 9p13.3 |
| Summary | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq, Sep 2014] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401047 | CCL21 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401047 | Transient overexpression lysate of chemokine (C-C motif) ligand 21 (CCL21) |
CNY 3080.00 |
|
| TP306579 | Recombinant protein of human chemokine (C-C motif) ligand 21 (CCL21), 20 µg |
CNY 2900.00 |
|
| TP723794 | Purified recombinant protein of Human chemokine (C-C motif) ligand 21 (CCL21 / 6CKine) |
CNY 4090.00 |
其它Exodus 2产品
